Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.3: Phage lysozyme [53981] (3 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries) many mutant structures |
Domain d1l61__: 1l61 - [36674] complexed with cl, seo; mutant |
PDB Entry: 1l61 (more details), 1.8 Å
SCOP Domain Sequences for d1l61__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l61__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4} mnifemlrideglrlkiykdtegyytigighlltkspnlnaakseldkaigrntngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
Timeline for d1l61__: