Lineage for d5y7ka1 (5y7k A:40-508)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. Domain d5y7ka1: 5y7k A:40-508 [366718]
    Other proteins in same PDB: d5y7ka2, d5y7kb2, d5y7kc2, d5y7kd2
    automated match to d1rwqa1
    complexed with 8vu

Details for d5y7ka1

PDB Entry: 5y7k (more details), 2.51 Å

PDB Description: crystal structure of human dpp4 in complex with inhibitor1
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5y7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y7ka1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d5y7ka1 are not available.

Timeline for d5y7ka1:

Domains from same chain:
(mouse over for more information)
d5y7ka2
Domains from other chains:
(mouse over for more information)
d5y7kb1, d5y7kb2, d5y7kc1, d5y7kc2, d5y7kd1, d5y7kd2