Lineage for d5zftb_ (5zft B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein automated matches [190161] (29 species)
    not a true protein
  7. Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)
  8. Domain d5zftb_: 5zft B: [366714]
    automated match to d2blma_
    complexed with ced; mutant

Details for d5zftb_

PDB Entry: 5zft (more details), 1.93 Å

PDB Description: crystal structure of beta-lactamase penp mutant-e166y in complex with cephaloridine as "pre-deacylation" intermediate
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5zftb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zftb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkalnm

SCOPe Domain Coordinates for d5zftb_ are not available.

Timeline for d5zftb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zfta_