Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
Domain d6nknc_: 6nkn C: [366712] Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknd_, d6nkne_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknq_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_ automated match to d1v54c_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn |
PDB Entry: 6nkn (more details), 2.5 Å
SCOPe Domain Sequences for d6nknc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nknc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d6nknc_:
View in 3D Domains from other chains: (mouse over for more information) d6nkna_, d6nknb1, d6nknb2, d6nknd_, d6nkne_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_ |