Lineage for d5zxlc_ (5zxl C:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624884Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2624885Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2624954Family e.22.1.0: automated matches [191565] (1 protein)
    not a true family
  6. 2624955Protein automated matches [190982] (12 species)
    not a true protein
  7. 2624978Species Escherichia coli [TaxId:83333] [366668] (1 PDB entry)
  8. 2624981Domain d5zxlc_: 5zxl C: [366693]
    automated match to d4mcaa_
    complexed with cl, gol, so4, zn

Details for d5zxlc_

PDB Entry: 5zxl (more details), 2.79 Å

PDB Description: structure of glda from e.coli
PDB Compounds: (C:) glycerol dehydrogenase

SCOPe Domain Sequences for d5zxlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zxlc_ e.22.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve
iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast
dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear
acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl
sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals
havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq
rflqewe

SCOPe Domain Coordinates for d5zxlc_:

Click to download the PDB-style file with coordinates for d5zxlc_.
(The format of our PDB-style files is described here.)

Timeline for d5zxlc_: