Lineage for d5zhqa2 (5zhq A:96-356)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. Protein automated matches [226885] (7 species)
    not a true protein
  7. Species Scylla paramamosain [TaxId:85552] [366674] (1 PDB entry)
  8. Domain d5zhqa2: 5zhq A:96-356 [366690]
    Other proteins in same PDB: d5zhqa1, d5zhqb1
    automated match to d4bg4b2
    complexed with so4

Details for d5zhqa2

PDB Entry: 5zhq (more details), 3 Å

PDB Description: crystal structure of scylla paramamosain arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d5zhqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zhqa2 d.128.1.2 (A:96-356) automated matches {Scylla paramamosain [TaxId: 85552]}
tdkhpnkdfgdvnqfvnvdpdgkfvistrvrcgrsmegypfnpclteaqykemeskvsst
lsnlegelkgtyypltgmtkdvqqkliddhflfkegdrflqaanacrywptgrgiyhndn
ktflvwcdeedhlriismqmggdlgqvyrrlvsavneiekrvpfshhdrlgfltfcptnl
gttvrasvhiklpklaanrekleevagkyslqvrgtrgehteaeggvydisnkrrmglte
fqavkemqdgilelikiekem

SCOPe Domain Coordinates for d5zhqa2 are not available.

Timeline for d5zhqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zhqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5zhqb1, d5zhqb2