Lineage for d5zhqa1 (5zhq A:2-95)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. Protein automated matches [226884] (9 species)
    not a true protein
  7. Species Scylla paramamosain [TaxId:85552] [366672] (1 PDB entry)
  8. Domain d5zhqa1: 5zhq A:2-95 [366689]
    Other proteins in same PDB: d5zhqa2, d5zhqb2
    automated match to d4bg4b1
    complexed with so4

Details for d5zhqa1

PDB Entry: 5zhq (more details), 3 Å

PDB Description: crystal structure of scylla paramamosain arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d5zhqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zhqa1 a.83.1.0 (A:2-95) automated matches {Scylla paramamosain [TaxId: 85552]}
adaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgvenl
dsgvgvyapdaeaytlfaplfdpiiedyhkgfkq

SCOPe Domain Coordinates for d5zhqa1 are not available.

Timeline for d5zhqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zhqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5zhqb1, d5zhqb2