Lineage for d5y7kc2 (5y7k C:509-764)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. Domain d5y7kc2: 5y7k C:509-764 [366678]
    Other proteins in same PDB: d5y7ka1, d5y7kb1, d5y7kc1, d5y7kd1
    automated match to d1rwqa2
    complexed with 8vu

Details for d5y7kc2

PDB Entry: 5y7k (more details), 2.51 Å

PDB Description: crystal structure of human dpp4 in complex with inhibitor1
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5y7kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y7kc2 c.69.1.24 (C:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOPe Domain Coordinates for d5y7kc2 are not available.

Timeline for d5y7kc2:

Domains from same chain:
(mouse over for more information)
d5y7kc1
Domains from other chains:
(mouse over for more information)
d5y7ka1, d5y7ka2, d5y7kb1, d5y7kb2, d5y7kd1, d5y7kd2