SCOPe 2.08: Domain d5zhqb1: 5zhq B:2-95

Lineage for d5zhqb1 (5zhq B:2-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Scylla paramamosain [TaxId:85552] [366672] (1 PDB entry)

8. Domain d5zhqb1: 5zhq B:2-95 [366673]
   Other proteins in same PDB: d5zhqa2, d5zhqb2
   automated match to d4bg4b1
   complexed with so4

Details for d5zhqb1

PDB Entry: 5zhq, 3 Å

PDB Description: crystal structure of scylla paramamosain arginine kinase

PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d5zhqb1:

Sequence; same for both SEQRES and ATOM records:

>d5zhqb1 a.83.1.0 (B:2-95) automated matches {Scylla paramamosain [TaxId: 85552]}
adaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgvenl
dsgvgvyapdaeaytlfaplfdpiiedyhkgfkq

Timeline for d5zhqb1:

• d5zhqb1 first appeared in SCOPe 2.07