![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein automated matches [337642] (1 species) not a true protein |
![]() | Species Epstein-barr virus (strain b95-8) [TaxId:10377] [366599] (1 PDB entry) |
![]() | Domain d6nppb_: 6npp B: [366656] Other proteins in same PDB: d6nppa1, d6nppa2 automated match to d1vhia_ protein/DNA complex; complexed with kwg |
PDB Entry: 6npp (more details), 1.35 Å
SCOPe Domain Sequences for d6nppb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nppb_ d.58.8.1 (B:) automated matches {Epstein-barr virus (strain b95-8) [TaxId: 10377]} snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni rvtvcsfddgvdlp
Timeline for d6nppb_: