Lineage for d6nppb_ (6npp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952704Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2952705Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2952774Protein automated matches [337642] (1 species)
    not a true protein
  7. 2952775Species Epstein-barr virus (strain b95-8) [TaxId:10377] [366599] (1 PDB entry)
  8. 2952776Domain d6nppb_: 6npp B: [366656]
    Other proteins in same PDB: d6nppa1, d6nppa2
    automated match to d1vhia_
    protein/DNA complex; complexed with kwg

Details for d6nppb_

PDB Entry: 6npp (more details), 1.35 Å

PDB Description: crystal structure of epstein-barr virus nuclear antigen-1, ebna1, bound to fragments
PDB Compounds: (B:) ebna1

SCOPe Domain Sequences for d6nppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nppb_ d.58.8.1 (B:) automated matches {Epstein-barr virus (strain b95-8) [TaxId: 10377]}
snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
rvtvcsfddgvdlp

SCOPe Domain Coordinates for d6nppb_:

Click to download the PDB-style file with coordinates for d6nppb_.
(The format of our PDB-style files is described here.)

Timeline for d6nppb_: