SCOPe 2.08: Domain d6npmb_: 6npm B:

Lineage for d6npmb_ (6npm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
   DNA-binding mode differs from that of E2 protein

7. Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries)

8. Domain d6npmb_: 6npm B: [366655]
   Other proteins in same PDB: d6npma2
   automated match to d1b3ta_
   protein/DNA complex; complexed with kvd
   has additional insertions and/or extensions that are not grouped together

Details for d6npmb_

PDB Entry: 6npm, 1.6 Å

PDB Description: crystal structure of epstein-barr virus nuclear antigen-1, ebna1, bound to fragments

PDB Compounds: (B:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d6npmb_:

Sequence; same for both SEQRES and ATOM records:

>d6npmb_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]}
snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
rvtvcsfddgvdlp

Timeline for d6npmb_:

• d6npmb_ first appeared in SCOPe 2.07