Lineage for d6jb7a2 (6jb7 A:157-200)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309397Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2309483Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 2309484Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries)
    Uniprot P61086 157-198
  8. 2309490Domain d6jb7a2: 6jb7 A:157-200 [366620]
    Other proteins in same PDB: d6jb7a1, d6jb7b_
    automated match to d5dfla2
    mutant

Details for d6jb7a2

PDB Entry: 6jb7 (more details), 2.1 Å

PDB Description: crystal structure of ub-conjugated ube2k c92k&k97a mutant (isopeptide linkage), 2.1 a resolution
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6jb7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jb7a2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn

SCOPe Domain Coordinates for d6jb7a2:

Click to download the PDB-style file with coordinates for d6jb7a2.
(The format of our PDB-style files is described here.)

Timeline for d6jb7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jb7a1
View in 3D
Domains from other chains:
(mouse over for more information)
d6jb7b_