Lineage for d6ntza2 (6ntz A:292-397)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430164Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2430165Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2430195Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 2430196Protein automated matches [231758] (5 species)
    not a true protein
  7. 2430197Species Escherichia coli [TaxId:562] [232620] (4 PDB entries)
  8. 2430210Domain d6ntza2: 6ntz A:292-397 [366610]
    Other proteins in same PDB: d6ntza1
    automated match to d1hd8a1
    complexed with mxr

Details for d6ntza2

PDB Entry: 6ntz (more details), 2.2 Å

PDB Description: crystal structure of e. coli pbp5-meropenem
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d6ntza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ntza2 b.105.1.0 (A:292-397) automated matches {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegnffgkiidyiklm

SCOPe Domain Coordinates for d6ntza2:

Click to download the PDB-style file with coordinates for d6ntza2.
(The format of our PDB-style files is described here.)

Timeline for d6ntza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ntza1