Lineage for d6nicc_ (6nic C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580913Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2580937Protein automated matches [190353] (3 species)
    not a true protein
  7. 2580947Species Medicago truncatula [TaxId:3880] [366571] (2 PDB entries)
  8. 2580951Domain d6nicc_: 6nic C: [366603]
    automated match to d1vkpb_
    complexed with edo, kqy, na, peg, pge

Details for d6nicc_

PDB Entry: 6nic (more details), 2.2 Å

PDB Description: crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide
PDB Compounds: (C:) Porphyromonas-type peptidyl-arginine deiminase

SCOPe Domain Sequences for d6nicc_:

Sequence, based on SEQRES records: (download)

>d6nicc_ d.126.1.6 (C:) automated matches {Medicago truncatula [TaxId: 3880]}
gfhmpaewephsqcwigwperadnwrdgavhaqlvftrvaaaisrfekvtvcassaqwen
arnqlpdhvrvveissndswfrdigptfvvrretsksddaehriagidwtfnswggledg
cycdwsldslvkkkildveriprfshsmvleggsihvdgegtcitteecllnknrnphls
ksqiedelkaylgvrkviwlprglygdddtnghvdnmccfvrpgavllswtddktdpqye
rseeayslfssvtdangrkfeviklhvpgplymtekeaagvfqddgakprlpgtrlaasy
vnfyiangaiiapqfgdkkwddeairvlsktfphhevvgiegsreivlsggnihcitqqq
pai

Sequence, based on observed residues (ATOM records): (download)

>d6nicc_ d.126.1.6 (C:) automated matches {Medicago truncatula [TaxId: 3880]}
gfhmpaewephsqcwigwperadnwrdgavhaqlvftrvaaaisrfekvtvcassaqwen
arnqlpdhvrvveissndswfrdigptfvvrredaehriagidwtfnswggledgcycdw
sldslvkkkildveriprfshsmvleggsihvdgegtcitteecllnknrnphlsksqie
delkaylgvrkviwlprglygdddtnghvdnmccfvrpgavllswtddktdpqyerseea
yslfssvtdangrkfeviklhvpgplymtekeaagvfqddgakprlpgtrlaasyvnfyi
angaiiapqfgdkkwddeairvlsktfphhevvgiegsreivlsggnihcitqqqpai

SCOPe Domain Coordinates for d6nicc_:

Click to download the PDB-style file with coordinates for d6nicc_.
(The format of our PDB-style files is described here.)

Timeline for d6nicc_: