![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
![]() | Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species) DNA-binding mode differs from that of E2 protein |
![]() | Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries) |
![]() | Domain d6nppa1: 6npp A:471-607 [366600] Other proteins in same PDB: d6nppa2, d6nppb_ automated match to d1b3ta_ protein/DNA complex; complexed with kwg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 6npp (more details), 1.35 Å
SCOPe Domain Sequences for d6nppa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nppa1 d.58.8.1 (A:471-607) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]} qggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipq crltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpapt cnirvtvcsfddgvdlp
Timeline for d6nppa1: