Lineage for d6jmja_ (6jmj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469073Species Acinetobacter baumannii [TaxId:405416] [340181] (10 PDB entries)
  8. 2469080Domain d6jmja_: 6jmj A: [366597]
    automated match to d5yh7a_
    complexed with asc, so4

Details for d6jmja_

PDB Entry: 6jmj (more details), 2.19 Å

PDB Description: crystal structure of the complex of phospho pantetheine adenylyl transferase from acinetobacter baumannii with ascorbic acid (vitamin- c) at 2.19 a resolution.
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6jmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jmja_ c.26.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

SCOPe Domain Coordinates for d6jmja_:

Click to download the PDB-style file with coordinates for d6jmja_.
(The format of our PDB-style files is described here.)

Timeline for d6jmja_:

  • d6jmja_ is new in SCOPe 2.07-stable
  • d6jmja_ does not appear in SCOPe 2.08