SCOPe 2.08: Domain d6jb6a2: 6jb6 A:157-200

Lineage for d6jb6a2 (6jb6 A:157-200)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries)
   Uniprot P61086 157-198

8. Domain d6jb6a2: 6jb6 A:157-200 [366582]
   Other proteins in same PDB: d6jb6a1, d6jb6a3, d6jb6b_
   automated match to d5dfla2
   mutant

Details for d6jb6a2

PDB Entry: 6jb6, 2.7 Å

PDB Description: crystal structure of ub-conjugated ube2k c92k&k97a mutant (isopeptide linkage), 2.7 a resolution

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6jb6a2:

Sequence; same for both SEQRES and ATOM records:

>d6jb6a2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn

Timeline for d6jb6a2:

• d6jb6a2 first appeared in SCOPe 2.07