![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries) Uniprot P61086 157-198 |
![]() | Domain d6jb6a2: 6jb6 A:157-200 [366582] Other proteins in same PDB: d6jb6a1, d6jb6a3, d6jb6b_ automated match to d5dfla2 mutant |
PDB Entry: 6jb6 (more details), 2.7 Å
SCOPe Domain Sequences for d6jb6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jb6a2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn
Timeline for d6jb6a2: