SCOPe 2.07: Domain d6jb6a1: 6jb6 A:1-156

Lineage for d6jb6a1 (6jb6 A:1-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (10 PDB entries)
   Uniprot P61086 1-156

8. Domain d6jb6a1: 6jb6 A:1-156 [366581]
   Other proteins in same PDB: d6jb6a2, d6jb6a3, d6jb6b_
   automated match to d5dfla1
   mutant

Details for d6jb6a1

PDB Entry: 6jb6, 2.7 Å

PDB Description: crystal structure of ub-conjugated ube2k c92k&k97a mutant (isopeptide linkage), 2.7 a resolution

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6jb6a1:

Sequence; same for both SEQRES and ATOM records:

>d6jb6a1 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaikldiladqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d6jb6a1:

• d6jb6a1 is new in SCOPe 2.07-stable
  
• d6jb6a1 appears in the current release, SCOPe 2.08