Lineage for d6n1zf_ (6n1z F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310354Protein Histone H2B [47119] (6 species)
  7. 2310355Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (40 PDB entries)
  8. 3066517Domain d6n1zf_: 6n1z F: [366579]
    automated match to d1kx5d_

Details for d6n1zf_

PDB Entry: 6n1z (more details), 2.7 Å

PDB Description: importin-9 bound to h2a-h2b
PDB Compounds: (F:) Histone H2B 1.1

SCOPe Domain Sequences for d6n1zf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n1zf_ a.22.1.1 (F:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkyts

SCOPe Domain Coordinates for d6n1zf_:

Click to download the PDB-style file with coordinates for d6n1zf_.
(The format of our PDB-style files is described here.)

Timeline for d6n1zf_:

  • d6n1zf_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-21

View in 3D
Domains from other chains:
(mouse over for more information)
d6n1zc_