Lineage for d6fv2c_ (6fv2 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797370Species Human coronavirus [TaxId:443239] [188597] (6 PDB entries)
  8. 2797382Domain d6fv2c_: 6fv2 C: [366546]
    automated match to d3tloa_
    complexed with d03, gol
    has additional subdomain(s) that are not in the common domain

Details for d6fv2c_

PDB Entry: 6fv2 (more details), 2.95 Å

PDB Description: structure of human coronavirus nl63 main protease in complex with the alpha-ketoamide (s)-n-benzyl-3-((s)-2-cinnamamido-3- phenylpropanamido)-2-oxo-4-((s)-2-oxopyrrolidin-3-yl)butanamide (cinnamoyl-phenylalanine-glnlactam-co-co-nh-benzyl)
PDB Compounds: (C:) 3C-like proteinase

SCOPe Domain Sequences for d6fv2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fv2c_ b.47.1.4 (C:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmyg

SCOPe Domain Coordinates for d6fv2c_:

Click to download the PDB-style file with coordinates for d6fv2c_.
(The format of our PDB-style files is described here.)

Timeline for d6fv2c_: