Lineage for d1l33__ (1l33 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d1l33__: 1l33 - [36654]
Details for d1l33__
PDB Entry: 1l33 (more details), 1.7 Å
PDB Description: contributions of left-handed helical residues to the structure and stability of bacteriophage t4 lysozyme
SCOP Domain Sequences for d1l33__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l33__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaaanlaksrwynqtpnrakrvittfrtgtwdayknl
SCOP Domain Coordinates for d1l33__:
Click to download the PDB-style file with coordinates for d1l33__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l33__:
- d1l33__ appears in SCOP 1.57
- d1l33__ appears in the current release, SCOPe 2.08, called d1l33a_
View in 3D