SCOPe 2.08: Domain d6jfwb1: 6jfw B:1-139

Lineage for d6jfwb1 (6jfw B:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)

8. Domain d6jfwb1: 6jfw B:1-139 [366538]
   Other proteins in same PDB: d6jfwa2, d6jfwb2, d6jfwc2, d6jfwd2
   automated match to d4zhvb_

Details for d6jfwb1

PDB Entry: 6jfw, 2 Å

PDB Description: crystal structure of pa0833 periplasmic domain from pseudomonas aeruginosa reveals an unexpected enlarged peptidoglycan binding pocket

PDB Compounds: (B:) PA0833-PD protein

SCOPe Domain Sequences for d6jfwb1:

Sequence; same for both SEQRES and ATOM records:

>d6jfwb1 d.79.7.0 (B:1-139) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
dkqeaelrrqmegtgvevqrqgddiklimpgnitfatdsaniapsfyaplnnlansfkqy
nqntieivgytdstgsrqhnmdlsqrraqsvagyltaqgvdgtrlstrgmgpdqpiasns
tadgraqnrrvevnlrpvp

Timeline for d6jfwb1:

• d6jfwb1 first appeared in SCOPe 2.07