Lineage for d6g2sa_ (6g2s A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767561Species Escherichia coli [TaxId:83333] [419302] (26 PDB entries)
  8. 2767616Domain d6g2sa_: 6g2s A: [366524]
    automated match to d5ab1a_
    complexed with ejn, so4

Details for d6g2sa_

PDB Entry: 6g2s (more details), 2.2 Å

PDB Description: crystal structure of fimh in complex with a pentaflourinated biphenyl alpha d-mannoside
PDB Compounds: (A:) Type 1 fimbrin D-mannose specific adhesin

SCOPe Domain Sequences for d6g2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2sa_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d6g2sa_:

Click to download the PDB-style file with coordinates for d6g2sa_.
(The format of our PDB-style files is described here.)

Timeline for d6g2sa_: