SCOPe 2.03: Domain d243la_: 243l A:

Lineage for d243la_ (243l A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (542 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d243la_: 243l A: [36652]
   complexed with cl, hed

Details for d243la_

PDB Entry: 243l, 1.75 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d243la_:

Sequence; same for both SEQRES and ATOM records:

>d243la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvatk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d243la_:

• d243la_ first appeared (with stable ids) in SCOP 1.55, called d243l__
  
• d243la_ appears in SCOPe 2.02
  
• d243la_ appears in SCOPe 2.04
  
• d243la_ appears in the current release, SCOPe 2.08