Lineage for d243l__ (243l -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129554Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 129555Protein Phage T4 lysozyme [53982] (1 species)
  7. 129556Species Bacteriophage T4 [TaxId:10665] [53983] (349 PDB entries)
  8. 129593Domain d243l__: 243l - [36652]

Details for d243l__

PDB Entry: 243l (more details), 1.75 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect

SCOP Domain Sequences for d243l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d243l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvatk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d243l__:

Click to download the PDB-style file with coordinates for d243l__.
(The format of our PDB-style files is described here.)

Timeline for d243l__: