Lineage for d6dcda_ (6dcd A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Mycobacterium marinum [TaxId:216594] [349760] (3 PDB entries)
  8. Domain d6dcda_: 6dcd A: [366498]
    automated match to d3a4ha_
    complexed with hem

Details for d6dcda_

PDB Entry: 6dcd (more details), 1.55 Å

PDB Description: mycobacterium marinum cytochrome p450 cyp150a6 in the substrate-free form
PDB Compounds: (A:) Cytochrome P450 150A6 Cyp150A6

SCOPe Domain Sequences for d6dcda_:

Sequence, based on SEQRES records: (download)

>d6dcda_ a.104.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
syesidfftdpslipdphpyfdylrsqspvlrlpqygvvavtgyeeatavykdtdsfsnc
valggpfpplpfapngddvnaqidahreqfpmyehmvtmdppehsrarsilsrlltpsrl
kqneefmwrladrqldeflgagecefiseyakpfatlviadllgvpeddrkdfrvvlgad
rmgrvgaldhesvgvnplqwlddkfsayiedrrrqprndvltalatatypdgstpevidv
vrsatflfaagqettaklltaamrvlgdrpdiqrrlrenrslipnfieeslrmdspvksd
srlarkrttvggldiaagtvvmvlpgaanrdprrfedphefrldrpnvrehmafargvhs
cpggplarvegrvslerildrmldiainedrhgpaddrrytyeptyilrgltelhitftp
ag

Sequence, based on observed residues (ATOM records): (download)

>d6dcda_ a.104.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
syesidfftdpslipdphpyfdylrsqspvlrlpqygvvavtgyeeatavykdtdsfsnc
valggpfpplpfapngddvnaqidahreqfpmyehmvtmdppehsrarsilsrlltpsrl
kqneefmwrladrqldeflgagecefiseyakpfatlviadllgvpeddrkdfrvvlgvn
plqwlddkfsayiedrrrqprndvltalatatypdgstpevidvvrsatflfaagqetta
klltaamrvlgdrpdiqrrlrenrslipnfieeslrmdspvksdsrlarkrttvggldia
agtvvmvlpgaanrdprrfedphefrldrpnvrehmafargvhscpggplarvegrvsle
rildrmldiainedrhgpaddrrytyeptyilrgltelhitftpag

SCOPe Domain Coordinates for d6dcda_ are not available.

Timeline for d6dcda_: