Lineage for d1l24__ (1l24 -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129554Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 129555Protein Phage T4 lysozyme [53982] (1 species)
  7. 129556Species Bacteriophage T4 [TaxId:10665] [53983] (349 PDB entries)
  8. 129581Domain d1l24__: 1l24 - [36648]

Details for d1l24__

PDB Entry: 1l24 (more details), 1.7 Å

PDB Description: enhanced protein thermostability from site-directed mutations that decrease the entropy of unfolding

SCOP Domain Sequences for d1l24__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l24__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnpklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d1l24__:

Click to download the PDB-style file with coordinates for d1l24__.
(The format of our PDB-style files is described here.)

Timeline for d1l24__: