Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Streptomyces rimosus [TaxId:1265868] [366478] (1 PDB entry) |
Domain d6fuxa_: 6fux A: [366479] automated match to d4feua_ complexed with adp, gol, sry |
PDB Entry: 6fux (more details), 1.65 Å
SCOPe Domain Sequences for d6fuxa_:
Sequence, based on SEQRES records: (download)
>d6fuxa_ d.144.1.0 (A:) automated matches {Streptomyces rimosus [TaxId: 1265868]} midltafltllradggdagwepvtdgesgaavfrsadgsryakcvpadqvaaleaerdrv swlstqdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhel ppekcpftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqea aqtvvchgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderws qsaeeefaarygialdrdrerfylhldpltwg
>d6fuxa_ d.144.1.0 (A:) automated matches {Streptomyces rimosus [TaxId: 1265868]} midltafltllradggdagwepvtaavfrsadgsryakcvpadqvaaleaerdrvswlst qdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhelppekc pftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqeaaqtvv chgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderwsqsaee efaarygialdrdrerfylhldpltwg
Timeline for d6fuxa_: