SCOPe 2.08: Domain d6hbjc_: 6hbj C:

Lineage for d6hbjc_ (6hbj C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Echovirus e18 [TaxId:47506] [366473] (3 PDB entries)

8. Domain d6hbjc_: 6hbj C: [366474]
   automated match to d2x5ic_

Details for d6hbjc_

PDB Entry: 6hbj, 3.16 Å

PDB Description: echovirus 18 empty particle

PDB Compounds: (C:) viral protein 3

SCOPe Domain Sequences for d6hbjc_:

Sequence, based on SEQRES records:

>d6hbjc_ b.121.4.1 (C:) automated matches {Echovirus e18 [TaxId: 47506]}
gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfma

Sequence, based on observed residues (ATOM records):

>d6hbjc_ b.121.4.1 (C:) automated matches {Echovirus e18 [TaxId: 47506]}
gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
ktksmdayqipvgttdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfc
gsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqsagyitcw
yqtnivvppgaptscdvlcfasacndfsvrllrdtpfma

Timeline for d6hbjc_:

• d6hbjc_ first appeared in SCOPe 2.07