Lineage for d6fwda_ (6fwd A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365078Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2365079Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2365080Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2365101Species Human (Homo sapiens) [TaxId:9606] [49475] (295 PDB entries)
    Uniprot P02766 31-143
  8. 3066409Domain d6fwda_: 6fwd A: [366471]
    automated match to d1bzea_
    mutant

Details for d6fwda_

PDB Entry: 6fwd (more details), 1.58 Å

PDB Description: crystal structure of human transthyretin double mutant r34g/t119m at ph 5.5
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6fwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwda_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfgkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp

SCOPe Domain Coordinates for d6fwda_:

Click to download the PDB-style file with coordinates for d6fwda_.
(The format of our PDB-style files is described here.)

Timeline for d6fwda_:

  • d6fwda_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-21

View in 3D
Domains from other chains:
(mouse over for more information)
d6fwdb_