Lineage for d6gmpa_ (6gmp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941847Species Trypanosoma brucei [TaxId:185431] [324134] (2 PDB entries)
  8. 2941848Domain d6gmpa_: 6gmp A: [366470]
    automated match to d1nmwa_

Details for d6gmpa_

PDB Entry: 6gmp (more details), 1.35 Å

PDB Description: crystal structure of the ppiase domain of tbpar42
PDB Compounds: (A:) parvulin 42

SCOPe Domain Sequences for d6gmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gmpa_ d.26.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
erhfyhvlvkhkdvrrpsslaprnkgekitrsradainlaqailaqhkerktwsldefvq
vvrdfsecgsakrdgdlgmvesgtytegfdtvafslksgevsapvetelgvhliyrve

SCOPe Domain Coordinates for d6gmpa_:

Click to download the PDB-style file with coordinates for d6gmpa_.
(The format of our PDB-style files is described here.)

Timeline for d6gmpa_: