Lineage for d1l59__ (1l59 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29167Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 29168Protein Phage T4 lysozyme [53982] (1 species)
  7. 29169Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries)
  8. 29197Domain d1l59__: 1l59 - [36647]

Details for d1l59__

PDB Entry: 1l59 (more details), 1.75 Å

PDB Description: analysis of the interaction between charged side chains and the alpha- helix dipole using designed thermostable mutants of phage t4 lysozyme

SCOP Domain Sequences for d1l59__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l59__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgengvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d1l59__:

Click to download the PDB-style file with coordinates for d1l59__.
(The format of our PDB-style files is described here.)

Timeline for d1l59__: