Lineage for d6g82a_ (6g82 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808422Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2808493Family b.68.6.2: Serum paraoxonase/arylesterase 1, PON1 [101895] (2 proteins)
  6. 2808499Protein automated matches [193803] (2 species)
    not a true protein
  7. 2808502Species Human (Homo sapiens) [TaxId:9606] [366467] (3 PDB entries)
  8. 2808504Domain d6g82a_: 6g82 A: [366468]
    automated match to d1v04a_
    complexed with ca; mutant

Details for d6g82a_

PDB Entry: 6g82 (more details), 2.4 Å

PDB Description: serum paraoxonase-1 by directed evolution with the l69s/h115w/f222s mutations
PDB Compounds: (A:) Serum paraoxonase-1 by directed evolution with the L69S/H115W/F222S mutations

SCOPe Domain Sequences for d6g82a_:

Sequence, based on SEQRES records: (download)

>d6g82a_ b.68.6.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissgskypgimsf
dpdksgkillmdlnekepavseleiigntldissfnpwgistfidddntvyllvvnhpgs
sstvevfkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemh
lglawsfvtyyspndvrvvaegfdsanginispdgkyvyiaellahkihvyekhanwtlt
plrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkv
tvvyaengtvlqgstvaavykgklligtvfhkalycdl

Sequence, based on observed residues (ATOM records): (download)

>d6g82a_ b.68.6.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissgskysgkill
mdlnekepavseleiigntldissfnpwgistfidddntvyllvvnhpgssstvevfkfq
eeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglawsfvty
yspndvrvvaegfdsanginispdgkyvyiaellahkihvyekhanwtltplrvlsfdtl
vdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyaengtv
lqgstvaavykgklligtvfhkalycdl

SCOPe Domain Coordinates for d6g82a_:

Click to download the PDB-style file with coordinates for d6g82a_.
(The format of our PDB-style files is described here.)

Timeline for d6g82a_: