SCOPe 2.07: Domain d6a7tb_: 6a7t B:

Lineage for d6a7tb_ (6a7t B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)

8. Domain d6a7tb_: 6a7t B: [366464]
   automated match to d2ox8a_
   complexed with ca

Details for d6a7tb_

PDB Entry: 6a7t, 1.6 Å

PDB Description: ca2+-independent c-type lectin spl-1 from saxidomus purpuratus

PDB Compounds: (B:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6a7tb_:

Sequence; same for both SEQRES and ATOM records:

>d6a7tb_ d.169.1.0 (B:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
ccseddcpsgwkffggscylfdegsrgwegskafceskdaslvtvecskeddfirgilsg
qtakhyywigarwneehndyrwidgspftfigwgpgkpdnnkgcldylnykevvwqwndh
vdcentngpciceidcsd

Timeline for d6a7tb_:

• d6a7tb_ is new in SCOPe 2.07-stable