Lineage for d6f56b1 (6f56 B:115-295)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575675Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)
  8. 2575733Domain d6f56b1: 6f56 B:115-295 [366454]
    automated match to d1iica1
    complexed with gol, mg, mya; mutant

Details for d6f56b1

PDB Entry: 6f56 (more details), 1.94 Å

PDB Description: mutant of human n-myristoyltransferase with bound myristoyl-coa
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d6f56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f56b1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
q

SCOPe Domain Coordinates for d6f56b1:

Click to download the PDB-style file with coordinates for d6f56b1.
(The format of our PDB-style files is described here.)

Timeline for d6f56b1: