Lineage for d6edea_ (6ede A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000788Species Clostridium thermocellum [TaxId:203119] [366438] (2 PDB entries)
  8. 3000790Domain d6edea_: 6ede A: [366449]
    automated match to d1wfxa_
    complexed with hqg

Details for d6edea_

PDB Entry: 6ede (more details), 1.55 Å

PDB Description: trna 2'-phosphotransferase
PDB Compounds: (A:) Probable RNA 2'-phosphotransferase

SCOPe Domain Sequences for d6edea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6edea_ d.166.1.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
idysklskevayalrhapweygleldaegwvdinqllsslhesekwkkvsehdlhvmiek
sdkkryeisngkiralyghsipqriikeqkcppevlyhgtarrfvksikekglqpqgrqy
vhlsadvetalqvgkrrdikpvllivnaleawsegikfylgndkvwladaipskyirf

SCOPe Domain Coordinates for d6edea_:

Click to download the PDB-style file with coordinates for d6edea_.
(The format of our PDB-style files is described here.)

Timeline for d6edea_: