SCOPe 2.08: Domain d6cocb1: 6coc B:1-258

Lineage for d6cocb1 (6coc B:1-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)

8. Domain d6cocb1: 6coc B:1-258 [366441]
   Other proteins in same PDB: d6coca2, d6cocb2
   automated match to d3dqza_
   complexed with cl, gol, hbx; mutant

Details for d6cocb1

PDB Entry: 6coc, 1.93 Å

PDB Description: athnl enantioselectivity mutant at-a9-h7 apo, y13c,y121l,p126f,l128w, c131t,f179l,a209i with benzaldehyde

PDB Compounds: (B:) Alpha-hydroxynitrile lyase

SCOPe Domain Sequences for d6cocb1:

Sequence; same for both SEQRES and ATOM records:

>d6cocb1 c.69.1.0 (B:1-258) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgslf
tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
skpqklfdslsaiatdym

Timeline for d6cocb1:

• d6cocb1 first appeared in SCOPe 2.07