Lineage for d6fv1a_ (6fv1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797370Species Human coronavirus [TaxId:443239] [188597] (6 PDB entries)
  8. 2797374Domain d6fv1a_: 6fv1 A: [366435]
    automated match to d3tloa_
    complexed with dms, e8e, gol, so4

    has additional subdomain(s) that are not in the common domain

Details for d6fv1a_

PDB Entry: 6fv1 (more details), 2.3 Å

PDB Description: structure of human coronavirus nl63 main protease in complex with the alpha-ketoamide (s)-n-((s)-4-(benzylamino)-3,4-dioxo-1-((s)-2- oxopyrrolidin-3-yl)butan-2-yl)-2-cinnamamido-4-methylpentanamide (cinnamoyl-leucine-glnlactam-co-co-nh-benzyl)
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d6fv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fv1a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv

SCOPe Domain Coordinates for d6fv1a_:

Click to download the PDB-style file with coordinates for d6fv1a_.
(The format of our PDB-style files is described here.)

Timeline for d6fv1a_: