Lineage for d6fxga_ (6fxg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915642Species Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries)
  8. 2915650Domain d6fxga_: 6fxg A: [366434]
    Other proteins in same PDB: d6fxgb2
    automated match to d4la9b_
    complexed with asn

Details for d6fxga_

PDB Entry: 6fxg (more details), 1.7 Å

PDB Description: crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
PDB Compounds: (A:) Amino acid ABC transporter membrane protein PAAT family

SCOPe Domain Sequences for d6fxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxga_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}
ettvkiasdssyapfefqngqkkwvgidvdimqevakindwklemsypgfdaalqnlkag
qvdgiiagmtitderketfdfsnpyytsaltiattkdsklsdysdlkgkavgakngtaaq
twlqenqkkygytiktysdgvhmfaalssgniagamdevpvisyamkqgqdlamnfpsis
lpggygfavmkgknstlvdgfnkalaemksngdydkilkkygita

SCOPe Domain Coordinates for d6fxga_:

Click to download the PDB-style file with coordinates for d6fxga_.
(The format of our PDB-style files is described here.)

Timeline for d6fxga_: