Lineage for d6ftma_ (6ftm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737582Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)
  8. 2737609Domain d6ftma_: 6ftm A: [366428]
    automated match to d4i15a_
    complexed with e6z, edo, fmt, gai, mg, zn

Details for d6ftma_

PDB Entry: 6ftm (more details), 2.1 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-048
PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6ftma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftma_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervletr

SCOPe Domain Coordinates for d6ftma_:

Click to download the PDB-style file with coordinates for d6ftma_.
(The format of our PDB-style files is described here.)

Timeline for d6ftma_: