Lineage for d6a7sb_ (6a7s B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 3066351Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)
  8. 3066353Domain d6a7sb_: 6a7s B: [366415]
    automated match to d2ox8a_
    complexed with ca, nga, so4, trs

Details for d6a7sb_

PDB Entry: 6a7s (more details), 2 Å

PDB Description: ca2+-independent c-type lectin spl-2 from saxidomus purpuratus
PDB Compounds: (B:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6a7sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a7sb_ d.169.1.0 (B:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
ccseddcpsgwkffggscylfdegsrgwegskafceskdaslvtvecskeddfirgilsg
qtakhyywigarwneehndyrwidgspftfigwgpgkpdnnkgcldylnykevvwqwndh
vdcentngpciceidcsd

SCOPe Domain Coordinates for d6a7sb_:

Click to download the PDB-style file with coordinates for d6a7sb_.
(The format of our PDB-style files is described here.)

Timeline for d6a7sb_:

  • d6a7sb_ is new in SCOPe 2.07-stable