Lineage for d6a7ta_ (6a7t A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 3066351Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)
  8. 3066352Domain d6a7ta_: 6a7t A: [366414]
    automated match to d2bpdb_
    complexed with ca

Details for d6a7ta_

PDB Entry: 6a7t (more details), 1.6 Å

PDB Description: ca2+-independent c-type lectin spl-1 from saxidomus purpuratus
PDB Compounds: (A:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6a7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a7ta_ d.169.1.0 (A:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq
safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq
dcvntkgpsicetdcse

SCOPe Domain Coordinates for d6a7ta_:

Click to download the PDB-style file with coordinates for d6a7ta_.
(The format of our PDB-style files is described here.)

Timeline for d6a7ta_:

  • d6a7ta_ is new in SCOPe 2.07-stable