SCOPe 2.07: Domain d6dyza_: 6dyz A:

Lineage for d6dyza_ (6dyz A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53175] (17 PDB entries)
   Uniprot Q13126

8. Domain d6dyza_: 6dyz A: [366409]
   automated match to d1cb0a_
   complexed with cl, edo, os2, po4

Details for d6dyza_

PDB Entry: 6dyz, 1.62 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol

PDB Compounds: (A:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d6dyza_:

Sequence; same for both SEQRES and ATOM records:

>d6dyza_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak
slllttipqigstewsetlhnlknmaqfsvllp

Timeline for d6dyza_:

• d6dyza_ is new in SCOPe 2.07-stable
  
• d6dyza_ appears in the current release, SCOPe 2.08