Lineage for d6dyza_ (6dyz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2464581Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2464582Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2464583Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2464584Species Human (Homo sapiens) [TaxId:9606] [53175] (17 PDB entries)
    Uniprot Q13126
  8. 3066347Domain d6dyza_: 6dyz A: [366409]
    automated match to d1cb0a_
    complexed with cl, edo, os2, po4

Details for d6dyza_

PDB Entry: 6dyz (more details), 1.62 Å

PDB Description: crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol
PDB Compounds: (A:) S-methyl-5'-thioadenosine phosphorylase

SCOPe Domain Sequences for d6dyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dyza_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak
slllttipqigstewsetlhnlknmaqfsvllp

SCOPe Domain Coordinates for d6dyza_:

Click to download the PDB-style file with coordinates for d6dyza_.
(The format of our PDB-style files is described here.)

Timeline for d6dyza_:

  • d6dyza_ is new in SCOPe 2.07-stable