Lineage for d6e20a_ (6e20 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375734Species Zebrafish (Danio rerio) [TaxId:7955] [270344] (3 PDB entries)
  8. 3066339Domain d6e20a_: 6e20 A: [366401]
    automated match to d5dg2b_
    complexed with gal, mg, ndg

Details for d6e20a_

PDB Entry: 6e20 (more details), 2 Å

PDB Description: crystal structure of the dario rerio galectin-1-l2
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d6e20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e20a_ b.29.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
agvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivcn
sfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykymy
fegevriqgvei

SCOPe Domain Coordinates for d6e20a_:

Click to download the PDB-style file with coordinates for d6e20a_.
(The format of our PDB-style files is described here.)

Timeline for d6e20a_:

  • d6e20a_ is new in SCOPe 2.07-stable