Lineage for d6e20a_ (6e20 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. Protein automated matches [190437] (67 species)
    not a true protein
  7. Species Zebrafish (Danio rerio) [TaxId:7955] [270344] (3 PDB entries)
  8. Domain d6e20a_: 6e20 A: [366401]
    automated match to d5dg2b_
    complexed with mg

Details for d6e20a_

PDB Entry: 6e20 (more details), 2 Å

PDB Description: crystal structure of the dario rerio galectin-1-l2
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d6e20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e20a_ b.29.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
agvliqnmsfkvgqtltitgvpkpdstnfainighspedialhmnprfdahgdqctivcn
sfqsgswceehrddnfpfiqdkefqikitftneeflvtlpdgseihfpnrqgsekykymy
fegevriqgvei

SCOPe Domain Coordinates for d6e20a_ are not available.

Timeline for d6e20a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6e20b_