Lineage for d6dyvb1 (6dyv B:1-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889092Species Helicobacter pylori [TaxId:85962] [227827] (10 PDB entries)
  8. 2889108Domain d6dyvb1: 6dyv B:1-230 [366393]
    Other proteins in same PDB: d6dyva2, d6dyvb2
    automated match to d4bn0b_
    complexed with edo, os3

Details for d6dyvb1

PDB Entry: 6dyv (more details), 1.62 Å

PDB Description: crystal structure of helicobacter pylori 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with (3r,4s)-1- ((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1- ylthio)methyl)pyrrolidin-3-ol
PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6dyvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dyvb1 c.56.2.0 (B:1-230) automated matches {Helicobacter pylori [TaxId: 85962]}
vqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
fvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d6dyvb1:

Click to download the PDB-style file with coordinates for d6dyvb1.
(The format of our PDB-style files is described here.)

Timeline for d6dyvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6dyvb2