Lineage for d6cobb_ (6cob B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903116Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. 2903137Domain d6cobb_: 6cob B: [366384]
    automated match to d3dqza_
    complexed with cl, gol; mutant

Details for d6cobb_

PDB Entry: 6cob (more details), 1.82 Å

PDB Description: athnl enantioselectivity mutant at-a9-h7 apo, y13c,y121l,p126f,l128w, c131t,f179l,a209i
PDB Compounds: (B:) Alpha-hydroxynitrile lyase

SCOPe Domain Sequences for d6cobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cobb_ c.69.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgslf
tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
skpqklfdslsaiatdym

SCOPe Domain Coordinates for d6cobb_:

Click to download the PDB-style file with coordinates for d6cobb_.
(The format of our PDB-style files is described here.)

Timeline for d6cobb_: