Lineage for d130l__ (130l -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76503Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 76504Protein Phage T4 lysozyme [53982] (1 species)
  7. 76505Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)
  8. 76516Domain d130l__: 130l - [36638]

Details for d130l__

PDB Entry: 130l (more details), 1.7 Å

PDB Description: structures of randomly generated mutants of t4 lysozyme show that protein stability can be enhanced by relaxation of strain and by improved hydrogen bonding via bound solvent

SCOP Domain Sequences for d130l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d130l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvistfrtgtwdayk

SCOP Domain Coordinates for d130l__:

Click to download the PDB-style file with coordinates for d130l__.
(The format of our PDB-style files is described here.)

Timeline for d130l__: