Lineage for d6codb1 (6cod B:1-258)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510596Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. 2510613Domain d6codb1: 6cod B:1-258 [366377]
    Other proteins in same PDB: d6coda2, d6codb2
    automated match to d3dqza_
    complexed with cl, gol, hbx; mutant

Details for d6codb1

PDB Entry: 6cod (more details), 1.8 Å

PDB Description: athnl enantioselectivity mutant at-a9-h7 apo y13c,y121l,p126f,l128w, c131t,f179l,a209i with benzaldehyde
PDB Compounds: (B:) Alpha-hydroxynitrile lyase

SCOPe Domain Sequences for d6codb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6codb1 c.69.1.0 (B:1-258) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
skpqklfdslsaiatdym

SCOPe Domain Coordinates for d6codb1:

Click to download the PDB-style file with coordinates for d6codb1.
(The format of our PDB-style files is described here.)

Timeline for d6codb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6codb2