Lineage for d6cqcc_ (6cqc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930242Family d.14.1.2: RNase P protein [54220] (2 proteins)
    automatically mapped to Pfam PF00825
  6. 2930253Protein automated matches [357987] (2 species)
    not a true protein
  7. 2930258Species Thermotoga maritima [TaxId:243274] [366347] (2 PDB entries)
  8. 2930262Domain d6cqcc_: 6cqc C: [366376]
    automated match to d1nz0c_
    protein/RNA complex; complexed with 8p4, so4

Details for d6cqcc_

PDB Entry: 6cqc (more details), 1.54 Å

PDB Description: rnase p protein from thermotoga maritima in complex with 1-(4- fluorophenyl)-2-thiourea
PDB Compounds: (C:) Ribonuclease P protein component

SCOPe Domain Sequences for d6cqcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqcc_ d.14.1.2 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
rlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre
ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie

SCOPe Domain Coordinates for d6cqcc_:

Click to download the PDB-style file with coordinates for d6cqcc_.
(The format of our PDB-style files is described here.)

Timeline for d6cqcc_: